PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.073130.1
Common NameCsa_2G427310, LOC101210479
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 302aa    MW: 32297.1 Da    PI: 8.1262
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.073130.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.34e-19954147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEd+ l ++v+++G+++W++I++ ++ gR++k+c++rw + 
   Cucsa.073130.1  9 KGPWSPEEDDALQRLVHKYGPRNWSLISKSIP-GRSGKSCRLRWCNQ 54
                     79******************************.***********985 PP

2Myb_DNA-binding52.11.5e-1663105347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++T++Ede +++a +++G++ W+tIar +  gRt++ +k++w++ 
   Cucsa.073130.1  63 AFTPDEDEAIINAQALYGNK-WATIARLLS-GRTDNAIKNHWNST 105
                      79******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.806159IPR017930Myb domain
SuperFamilySSF466893.24E-316102IPR009057Homeodomain-like
SMARTSM007171.4E-17857IPR001005SANT/Myb domain
PfamPF002493.3E-19954IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.9E-261062IPR009057Homeodomain-like
CDDcd001675.01E-171153No hitNo description
SMARTSM007175.2E-1460108IPR001005SANT/Myb domain
PROSITE profilePS5129420.95561110IPR017930Myb domain
PfamPF002492.7E-1363105IPR001005SANT/Myb domain
CDDcd001671.07E-1163106No hitNo description
Gene3DG3DSA:1.10.10.601.3E-2163109IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MSKQTDRIKG PWSPEEDDAL QRLVHKYGPR NWSLISKSIP GRSGKSCRLR WCNQLSPQVE  60
HRAFTPDEDE AIINAQALYG NKWATIARLL SGRTDNAIKN HWNSTLKRKC SSMPDDTGGC  120
HATSPPFKKS VSAGLYMPPN SPSGSDLSDS GFFPAVSSSH VFRPVPRTGA VLPPGETVSS  180
SDDPPTSLSL SLPGADSSEV NFVANSVQGV GGVSERRSTG LACSATANGE ERISGEKEES  240
NSNGFGIFSS DLMAVMQEMI RKEVRNYMAG LMEQKVGGGG GVCYQQAAAG GFRNVVVQRI  300
D*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-3961124110B-MYB
1gv2_A9e-3981103105MYB PROTO-ONCOGENE PROTEIN
1mse_C1e-3881103105C-Myb DNA-Binding Domain
1msf_C1e-3881103105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819150.0LN681915.1 Cucumis melo genomic scaffold, anchoredscaffold00070.
GenBankLN7132650.0LN713265.1 Cucumis melo genomic chromosome, chr_11.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011650034.10.0PREDICTED: transcription factor MYB44-like
SwissprotQ9FDW11e-88MYB44_ARATH; Transcription factor MYB44
TrEMBLA0A0A0LTE40.0A0A0A0LTE4_CUCSA; Uncharacterized protein
STRINGVIT_07s0129g01050.t011e-116(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF84334124
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G67300.12e-84myb domain protein r1
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]